PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B02313.1.p
Common NameEUGRSUZ_B02313, LOC104432696
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 337aa    MW: 37255.9 Da    PI: 4.51
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B02313.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.48.6e-30168221155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       +prl+Wtp+LH+rFv++v++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYR+
  Eucgr.B02313.1.p 168 RPRLVWTPQLHKRFVDVVAHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRV 221
                       59*******************.********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.73E-19165225IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-30165226IPR009057Homeodomain-like
PROSITE profilePS5129410.663165224IPR017930Myb domain
TIGRFAMsTIGR015573.4E-23169221IPR006447Myb domain, plants
PfamPF002496.0E-8171220IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MSESDDLRHG RGGGSGDGEL DGEDPVAEWE FGLPSCDDLA PLSQALIPPD LASAFSIALR  60
PSRTAGDVNR ASRSTLTGLR RCGSTASSQG FSTNDNFKSF VDDRQSMEVE VEEEEKEEEE  120
EEEEEEEEDG ADKSDSRKSR RIETAEEVDS TPRMDDSQED PSEKTSKRPR LVWTPQLHKR  180
FVDVVAHLGI KNAVPKTIMQ LMNVEGLTRE NVASHLQKYR VYLRRMQGMS SEGLSSSDQL  240
FTSTPVVHSL NYVAGSTGHG DGQMPMPTPV PYGAQPPMMP MPVYAMGHGY GHMRMQIGDL  300
SGFESNQYVT QQRDWSSNKY GSVASYQQTA SNEKRF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-21167226463ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B02313.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010043501.10.0PREDICTED: transcription factor PCL1-like
SwissprotQ9SNB41e-79PCL1_ARATH; Transcription factor LUX
TrEMBLA0A059D5N90.0A0A059D5N9_EUCGR; Uncharacterized protein
STRINGVIT_06s0004g05120.t011e-105(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40552758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.22e-77G2-like family protein